Fadverdirect.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Google
Description N/A
Keywords N/A
Server Information
WebSite fadverdirect favicon www.fadverdirect.com
Host IP 3.90.133.137
Location Ashburn, Virginia, United States
Related Websites
Site Rank
More to Explore
farmacityfcdmidentityserver-prod.azurewebsites.net
felixfurniture.com
felixmag.co
fixtroublecodes.com
fragrancesofireland.com
freemalware.club
gazatimber.co.uk
gelou.com.co
gemmaco.gr
generaltag.com
dongfamily.name
downloadfreeringtoness.com
Fadverdirect.com Valuation
US$2,448,901
Last updated: Sep 16, 2021

Fadverdirect.com has global traffic rank of 9,449 and ranks the 4,022nd in United States. Its global rank has gone up by 421,107 positions since 3 months ago. Fadverdirect.com has an estimated worth of US$ 2,448,901, based on its estimated Ads revenue. Fadverdirect.com receives approximately 344,067 unique visitors each day. Its web server is located in Ashburn, Virginia, United States, with IP address 3.90.133.137. According to SiteAdvisor, fadverdirect.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$2,448,901
Daily Ads Revenue US$1,341
Monthly Ads Revenue US$40,255
Yearly Ads Revenue US$489,780
Daily Unique Visitors 344,067
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 9,449
Delta (90 Days) ⬆️ 421,107
Most Popular In Country United States
Country Rank 4,022
DNS Records
Host Type TTL Data
fadverdirect.com A 21600 IP: 3.90.133.137
fadverdirect.com NS 21600 Target: ns-1870.awsdns-41.co.uk.
fadverdirect.com NS 21600 Target: ns-298.awsdns-37.com.
fadverdirect.com NS 21600 Target: ns-645.awsdns-16.net.
fadverdirect.com NS 21600 Target: ns-1480.awsdns-57.org.
fadverdirect.com SOA 3600 MNAME: ns-298.awsdns-37.com.
RNAME: awsdns-hostmaster.amazon.com.
Serial: 1
Refresh: 7200
Retry: 900
Expire: 1209600
Minimum TTL: 86400
HTTP Headers
HTTP/1.1 301 Moved Permanently
Content-Type: text/html; charset=UTF-8
Location: https://www.google.com
Server: Microsoft-IIS/8.5
X-Powered-By: PHP/7.3.7
X-Powered-By: ASP.NET
Date: Thu, 16 Sep 2021 16:12:49 GMT
Content-Length: 145
Vary: Accept-Encoding

HTTP/2 302 
location: https://www.google.com/sorry/index?continue=https://www.google.com/&q=EhAmADwDAAAAAPA8kv_-FvALGIHajYoGIhACNtPUUxfJ31_mupVgmePcMgFy
date: Thu, 16 Sep 2021 16:12:50 GMT
pragma: no-cache
expires: Fri, 01 Jan 1990 00:00:00 GMT
cache-control: no-store, no-cache, must-revalidate
content-type: text/html; charset=UTF-8
server: HTTP server (unknown)
content-length: 331
x-xss-protection: 0
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000,h3-T051=":443"; ma=2592000,h3-Q050=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000,quic=":443"; ma=2592000; v="46,43"

HTTP/2 429 
date: Thu, 16 Sep 2021 16:12:50 GMT
pragma: no-cache
expires: Fri, 01 Jan 1990 00:00:00 GMT
cache-control: no-store, no-cache, must-revalidate
content-type: text/html
server: HTTP server (unknown)
content-length: 2805
x-xss-protection: 0
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000,h3-T051=":443"; ma=2592000,h3-Q050=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000,quic=":443"; ma=2592000; v="46,43"

Fadverdirect.com Whois Information
   Domain Name: FADVERDIRECT.COM
   Registry Domain ID: 2609639001_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.godaddy.com
   Registrar URL: http://www.godaddy.com
   Updated Date: 2021-05-04T11:13:17Z
   Creation Date: 2021-05-04T10:57:07Z
   Registry Expiry Date: 2022-05-04T10:57:07Z
   Registrar: GoDaddy.com, LLC
   Registrar IANA ID: 146
   Registrar Abuse Contact Email: abuse@godaddy.com
   Registrar Abuse Contact Phone: 480-624-2505
   Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
   Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: NS-1480.AWSDNS-57.ORG
   Name Server: NS-1870.AWSDNS-41.CO.UK
   Name Server: NS-298.AWSDNS-37.COM
   Name Server: NS-645.AWSDNS-16.NET
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: fadverdirect.com
Registry Domain ID: 2609639001_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-05-04T04:13:17Z
Creation Date: 2021-05-04T05:57:07Z
Registrar Registration Expiration Date: 2022-05-04T05:57:07Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 2155 E Warner Rd
Registrant City: Tempe
Registrant State/Province: Arizona
Registrant Postal Code: 85284
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: fadverdirect.com@domainsbyproxy.com
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 2155 E Warner Rd
Tech City: Tempe
Tech State/Province: Arizona
Tech Postal Code: 85284
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: fadverdirect.com@domainsbyproxy.com
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 2155 E Warner Rd
Admin City: Tempe
Admin State/Province: Arizona
Admin Postal Code: 85284
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: fadverdirect.com@domainsbyproxy.com
Name Server: NS-298.AWSDNS-37.COM
Name Server: NS-1870.AWSDNS-41.CO.UK
Name Server: NS-645.AWSDNS-16.NET
Name Server: NS-1480.AWSDNS-57.ORG
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

-status-codes-2014-06-16-en

without notice.